Fat Loss & MetabolicHuman trialsSubcutaneousOral

Semaglutide

Sema · Ozempic · Wegovy · Rybelsus · NN9535

Long-acting GLP-1 agonist dosed weekly; the reference compound for appetite-driven fat loss.

Typical dose

1 mg

Once weekly

Range

0.25–2.4

mg

Half-life

7 days

see Dosing

Evidence

Human trials

Subcutaneous · Oral

What it is

Semaglutide is a GLP-1 receptor agonist built from the human GLP-1 backbone, modified with an Aib substitution and a C18 diacid fatty chain that binds albumin. That modification is what turns a peptide with a two-minute native half-life into one dosed once a week.

It is approved for type 2 diabetes (Ozempic, Rybelsus) and for weight management (Wegovy). In the STEP 1 trial, 2.4 mg weekly produced roughly 15% mean body weight loss over 68 weeks against about 2.4% on placebo. It is the compound most other incretins get benchmarked against.

In a bodybuilding context it is used almost entirely as an appetite tool: it makes a deficit tolerable rather than burning fat directly. The trade-off is that a meaningful share of the weight lost is lean tissue unless training volume and protein intake are held up deliberately.

Grey-market lyophilised semaglutide is widely sold and is chemically the same molecule, but purity and actual mg content vary by source. Third-party testing is the only way to know what is in a vial.

How it works

Semaglutide activates GLP-1 receptors in the hypothalamus and brainstem, which raises satiety signalling and lowers the drive to eat. It also slows gastric emptying, so food sits in the stomach longer and meals feel larger than they are. The combined effect is a large, sustained drop in spontaneous calorie intake.

In the pancreas it increases glucose-dependent insulin secretion and suppresses glucagon, which is why it lowers blood sugar without much hypoglycaemia risk on its own. The albumin-binding fatty acid chain and DPP-4 resistance from the Aib substitution give it a roughly week-long half-life, so plasma levels stay flat between injections.

Dosing

Typical single dose1 mg
Reported range0.25–2.4 mg
FrequencyOnce weekly
Injections per week1
Half-life~7 days (165-184 hours, subcutaneous); steady state reached after 4-5 weekly doses
TimingAny time of day, with or without food. Pick a fixed day of the week and stay on it; the long half-life makes exact timing irrelevant.
RoutesSubcutaneous, Oral
Molecular weight4114 Da
SequenceH-Aib-EGTFTSDVSSYLEGQAAKEFIAWLVRGRG

Nobody starts at 1 mg. Everyone titrates from 0.25 mg with roughly 4 weeks at each step, and the ceiling is 2.4 mg weekly for weight management (2 mg for the diabetes label). Every number in this entry is for the subcutaneous route only. Oral semaglutide is a separate product on a separate schedule — 3-14 mg once daily as Rybelsus, with a higher-dose 25 mg once-daily tablet for weight management — and none of the vial, reconstitution or weekly-dose figures here apply to it.

Standard titration

StepDoseNote
Weeks 1-40.25 mgTolerance-building dose, not expected to drive much weight loss
Weeks 5-80.5 mgFirst dose where appetite suppression is usually obvious
Weeks 9-121 mgCommon long-term maintenance dose; many people stop here
Weeks 13-161.7 mgOnly escalate if weight loss has genuinely stalled
Week 17 onward2.4 mgLabel maximum for weight management; side effects scale with dose

Reconstitution calculator

Pre-loaded with Semaglutide’s vial size, water volume and typical dose. Change anything.

Typical: 1 mg · range 0.25–2.4

0102030405040 units0.5 mL insulin · U-100 · 1-unit marks

Draw to

40 u

0.4 mL · 1 mg

Concentration

2.5 mg/mL

25 mcg per unit

Doses per vial

5

Vial lasts

5 weeks

Draw to 40 units on the barrel.

Once mixed
Refrigerate at 2-8C and use within about 4-6 weeks; discard sooner if the solution turns cloudy or shows particles. This vial would take about 5 weeks to finish — check that against the storage window before mixing the whole thing.

Full calculator
Suggested water2 mL per 5 mg vial
Common vial sizes5 mg, 10 mg

A 5 mg vial with 2 mL bacteriostatic water gives 2.5 mg/mL, so 0.25 mg is 10 units on a U-100 insulin syringe and 2.4 mg is 96 units. Add the water slowly down the inside wall, then swirl or roll the vial; do not shake, as agitation denatures the peptide and causes foaming.

Storage

Before mixing

Refrigerated at 2-8C the sealed powder is stable for years; it tolerates several weeks at room temperature during shipping, but keep it dark and dry.

After mixing

Refrigerate at 2-8C and use within about 4-6 weeks; discard sooner if the solution turns cloudy or shows particles.

Reported benefits

  • Large, reliable drop in appetite and food preoccupation
  • Roughly 15% mean body weight loss over 68 weeks at 2.4 mg in trial conditions
  • Once-weekly dosing with flat plasma levels and no timing pressure
  • Improves HbA1c, fasting glucose and insulin sensitivity
  • Reduced major cardiovascular events in both diabetic and non-diabetic obese populations
  • Lowers blood pressure and triglycerides alongside the weight loss

Side effects

  • Nausea, vomiting, diarrhoea and constipation, worst in the first weeks after each dose increase
  • Sulphurous burps and reflux from delayed gastric emptying
  • Significant lean mass loss if protein and resistance training are not maintained
  • Fatigue and reduced training capacity from low calorie intake, not from the drug itself
  • Gallstones, driven mainly by the rate of weight loss
  • Acute pancreatitis, rare but documented
  • Loss of appetite so complete that hitting a protein target becomes the limiting factor
  • Markedly delayed gastric emptying — the stomach can still hold solid food many hours after a meal, so any surgery, endoscopy or procedural sedation needs the drug held beforehand and the anaesthetist told, because of the aspiration risk from retained gastric contents.

Do not use if

  • Personal or family history of medullary thyroid carcinoma or MEN2 syndrome
  • History of pancreatitis
  • Gastroparesis or other significant gastric motility disorder
  • Pregnancy or trying to conceive; wash out at least 2 months beforehand given the half-life
  • Type 1 diabetes as a substitute for insulin

Evidence level — Human trials

Controlled human clinical data exists.

FDA- and EMA-approved as a prescription drug (Ozempic, Wegovy, Rybelsus); lyophilised vials sold outside that channel are unlicensed research-chemical supply.

Commonly run with

Semaglutide FAQ

Will I lose muscle on semaglutide?+

Yes, some. Trial data show roughly 30-40% of the total weight lost is lean mass, which is broadly what any large deficit produces. Keeping protein around 2 g/kg and holding your resistance training volume is what changes that number, not the dose.

What happens when I stop?+

Appetite returns over about 4-6 weeks as the drug clears, and the STEP 1 extension showed participants regained roughly two thirds of the lost weight within a year off drug. It is a tool for building eating habits during the window it is working, not a fix on its own.

Can I run it while bulking or on cycle?+

People do use low doses (0.25-0.5 mg) to blunt appetite on a lean bulk or to manage glucose while on high-dose anabolics. It works, but at any dose it slows gastric emptying, which makes hitting a surplus genuinely hard.

Why did the nausea come back after weeks of being fine?+

Almost always a dose increase. GI side effects reset with each titration step and typically settle within one to two weeks. If they do not, drop back to the previous step and hold there longer rather than pushing through.

Is grey-market semaglutide the same molecule?+

Chemically it can be identical, since the synthesis is well documented. What varies is purity, actual mg per vial, and residual solvents. Anything without a recent third-party HPLC and mass spec report on that specific batch is unverified.

References

  1. 1.Once-Weekly Semaglutide in Adults with Overweight or ObesityNew England Journal of Medicine (2021) PMID 33567185
  2. 2.Semaglutide and Cardiovascular Outcomes in Obesity without DiabetesNew England Journal of Medicine (2023) PMID 37952131
  3. 3.Semaglutide and Cardiovascular Outcomes in Patients with Type 2 DiabetesNew England Journal of Medicine (2016) PMID 27633186

Related reading

More Fat Loss & Metabolic